(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE459

ASPNC_1.PE459        Location/Qualifiers
FT   CDS             join(1146084..1146163,1146248..1146355,1146470..1146570,
FT                   1146991..1147190,1147272..1147322)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960444"
FT                   /orf_name="An01g04820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37016.1"
FT                   /db_xref="UniParc:UPI0000EF9EDF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L9"
FT                   /transl_table=1
FT                   /translation="MVDGAELSYFAPLSPPRPIRIYAHTNAPSPRGLAGTPYVEGVCAL
FT                   GAVPGRIAYLVGGPPPPFIPGGTHPVDKYLSMVSESWCALAESQSHSNWESGGYPNPNL
FT                   AKSIIDHPLTSHTEILRHPIMWWESAQISTSRLCCANLVLLVASGSTLFQGGGVAAFSL
FT                   VGGVVVVVMTLPYYWG"
     MVDGAELSYF APLSPPRPIR IYAHTNAPSP RGLAGTPYVE GVCALGAVPG RIAYLVGGPP        60
     PPFIPGGTHP VDKYLSMVSE SWCALAESQS HSNWESGGYP NPNLAKSIID HPLTSHTEIL       120
     RHPIMWWESA QISTSRLCCA NLVLLVASGS TLFQGGGVAA FSLVGGVVVV VMTLPYYWG        179
//

If you have problems or comments...

PBIL Back to PBIL home page