(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE46

ASPNC_1.PE46         Location/Qualifiers
FT   CDS             join(complement(130945..131021),complement(130637..130751))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874701"
FT                   /orf_name="An01g00520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43440.1"
FT                   /db_xref="UniParc:UPI0000EF9F3F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F6"
FT                   /transl_table=1
FT                   /translation="MSSSGKDFSYKGSGTNSQVSAIAYRIDGSYYYSNPNGSTYYNNGN
FT                   GGSTYTPPSGNGGSTGKK"
     MSSSGKDFSY KGSGTNSQVS AIAYRIDGSY YYSNPNGSTY YNNGNGGSTY TPPSGNGGST        60
     GKK                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page