(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE461

ASPNC_1.PE461        Location/Qualifiers
FT   CDS             join(complement(1158051..1158131),
FT                   complement(1157575..1157888),complement(1157037..1157262))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878884"
FT                   /orf_name="An01g04840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37018.1"
FT                   /db_xref="UniParc:UPI0000EF9EE1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M1"
FT                   /transl_table=1
FT                   /translation="MNRGDGTAVPCLWCRGIQIEWASEHLCPVAPARRYSGPDSRLRMI
FT                   PMSIPTLPGMRQSQKIPNLQRALAGSAPITAPTQTVHVLGNGPRGVEEGSSLRPVRMRV
FT                   SGGQWALPAKGEAKSSRVTNRSIGVLTTRRGGGGGAGACPRSRYTLTPLCNHSEVLFVI
FT                   FPHLSQIGNLLPCPLLSLSLFFSFFLPFLPSIRISNSEVARPA"
     MNRGDGTAVP CLWCRGIQIE WASEHLCPVA PARRYSGPDS RLRMIPMSIP TLPGMRQSQK        60
     IPNLQRALAG SAPITAPTQT VHVLGNGPRG VEEGSSLRPV RMRVSGGQWA LPAKGEAKSS       120
     RVTNRSIGVL TTRRGGGGGA GACPRSRYTL TPLCNHSEVL FVIFPHLSQI GNLLPCPLLS       180
     LSLFFSFFLP FLPSIRISNS EVARPA                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page