(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE467

ASPNC_1.PE467        Location/Qualifiers
FT   CDS             join(1170822..1170965,1171038..1172321)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212188" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654555"
FT                   /orf_name="An01g04900"
FT                   /product="Similarity to hypothetical protein CAC18296.1 -
FT                   Neurospora crassa"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAK37024.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG329984"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR019416"
FT                   /db_xref="UniParc:UPI0000EF9EE7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M7"
FT                   /transl_table=1
FT                   /translation="MEVASAQQPSLQLDASNAAPVADTMDASMDIDMDIDLGPLPEAEP
FT                   IETEQTLVATTAVQDGSIDPLNEEAQYEKVHIRGVDELTTDNIKQFAVEHFALEEPSRV
FT                   EWIDDTSANILYSSPEVGLQALSAFTQVSEEEDASALPALRLRSAKLLSTHPDSVLQVR
FT                   SAVKADRKKPRAHEASRFYLMHPEHDPRERLRREFADRRRSGGGDVSDGDYRRRRFDGR
FT                   ELQRRRDRDAGESFSANMYDDTVPASRDRSSDRSRERRGRRGGRDLFPQEEGRLSGRLR
FT                   NRSASPGRDTLMEGGYAEDDRQDRRRFRDRSPQLGRRNEGKELFPSSGAKSSDANAREL
FT                   FPNRTAKELFPQKVSNHRRSDAIDGADETADLFSRRISVPLVDGSQDQQPARRKRDIEL
FT                   FPETTETSGLNIRGAARQDQGMSIRGAANGISIKGRGASVRELFPNKYGSNAGKELFSD
FT                   KIEGRGGPRRRAEDMFS"
     MEVASAQQPS LQLDASNAAP VADTMDASMD IDMDIDLGPL PEAEPIETEQ TLVATTAVQD        60
     GSIDPLNEEA QYEKVHIRGV DELTTDNIKQ FAVEHFALEE PSRVEWIDDT SANILYSSPE       120
     VGLQALSAFT QVSEEEDASA LPALRLRSAK LLSTHPDSVL QVRSAVKADR KKPRAHEASR       180
     FYLMHPEHDP RERLRREFAD RRRSGGGDVS DGDYRRRRFD GRELQRRRDR DAGESFSANM       240
     YDDTVPASRD RSSDRSRERR GRRGGRDLFP QEEGRLSGRL RNRSASPGRD TLMEGGYAED       300
     DRQDRRRFRD RSPQLGRRNE GKELFPSSGA KSSDANAREL FPNRTAKELF PQKVSNHRRS       360
     DAIDGADETA DLFSRRISVP LVDGSQDQQP ARRKRDIELF PETTETSGLN IRGAARQDQG       420
     MSIRGAANGI SIKGRGASVR ELFPNKYGSN AGKELFSDKI EGRGGPRRRA EDMFS            475
//

If you have problems or comments...

PBIL Back to PBIL home page