(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE468

ASPNC_1.PE468        Location/Qualifiers
FT   CDS             join(1172737..1172998,1173055..1174205,1174321..1174359,
FT                   1174471..1174617)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960445"
FT                   /orf_name="An01g04910"
FT                   /product="Similarity to hypothetical protein EAK99938.1 -
FT                   Candida albicans"
FT                   /protein_id="CAK37025.1"
FT                   /db_xref="HOGENOM:HBG329985"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000EF9EE8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M8"
FT                   /transl_table=1
FT                   /translation="MPPPSQNIPLASTLVARFLRTNNYTQTLKAFLQEAGLPSDAGEQS
FT                   GKDDATNWTIENLIEEKKAYDQSKNFERYGDNDKDKDVWTVPAPTKPNIIQTPSSSNLL
FT                   ACSVGQWQRPDAQAEPYLIATGADKHLHLFQTSPGHDLVQSFTGTSEAPILSYIPVQDG
FT                   KYILMTNMSGQLLLQKGAEIIDRRKDHAKYAVKVIAYEQKNNNDTADTFSTTTTIWIAT
FT                   AGWDSKIFLYRMQINDEAPTQIGDPIASIPLLSNPESILFTTHIDNPQDLILLVSRRDS
FT                   SNLYYYHVKPSAVSTTGYECPLIGKQNLAPHSNAWVAFSPSCLALSPHDPGLIAIATST
FT                   LPHMKVMIVRLLFPSAESLESGSAEQEQEPATQAAQAFAALSLQNREDAAILIQANTFA
FT                   PQTAYSTPQVVWRPDGSGVWVNGDDGVVRGLEVKTGKVVTLLKDGHEVGCKIRTLWAGW
FT                   VDGENGGEREEWLFSSIHYQPTWATTQARMEKISTELYTHMPVSSPTSSSTSPPTTLRY
FT                   ENRTSEKQMNHQPRE"
     MPPPSQNIPL ASTLVARFLR TNNYTQTLKA FLQEAGLPSD AGEQSGKDDA TNWTIENLIE        60
     EKKAYDQSKN FERYGDNDKD KDVWTVPAPT KPNIIQTPSS SNLLACSVGQ WQRPDAQAEP       120
     YLIATGADKH LHLFQTSPGH DLVQSFTGTS EAPILSYIPV QDGKYILMTN MSGQLLLQKG       180
     AEIIDRRKDH AKYAVKVIAY EQKNNNDTAD TFSTTTTIWI ATAGWDSKIF LYRMQINDEA       240
     PTQIGDPIAS IPLLSNPESI LFTTHIDNPQ DLILLVSRRD SSNLYYYHVK PSAVSTTGYE       300
     CPLIGKQNLA PHSNAWVAFS PSCLALSPHD PGLIAIATST LPHMKVMIVR LLFPSAESLE       360
     SGSAEQEQEP ATQAAQAFAA LSLQNREDAA ILIQANTFAP QTAYSTPQVV WRPDGSGVWV       420
     NGDDGVVRGL EVKTGKVVTL LKDGHEVGCK IRTLWAGWVD GENGGEREEW LFSSIHYQPT       480
     WATTQARMEK ISTELYTHMP VSSPTSSSTS PPTTLRYENR TSEKQMNHQP RE               532
//

If you have problems or comments...

PBIL Back to PBIL home page