(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE476

ASPNC_1.PE476        Location/Qualifiers
FT   CDS             complement(1189457..1190668)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212246" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960448"
FT                   /orf_name="An01g04990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37033.1"
FT                   /db_xref="HOGENOM:HBG329990"
FT                   /db_xref="UniParc:UPI0000EF9F0A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N6"
FT                   /transl_table=1
FT                   /translation="MTESYGLDEPRTPGLRPTEIDYLPKVSPPPFDTGDQSPKGGLPKH
FT                   DAEAQFPSSSRKLPEFQKPDSTEGNSVLIRHLEPNRPDIAWFETEHPLQRSTIADDFPV
FT                   LPKIIFGPEKSSVETKEPVDVVARKALNLISPSEPKEGGPSVAPKDLPVAYKEPPRRPS
FT                   IPVEEPALKEEQQQQHTPPNIPHFSHLFQDGKLPDPETRLGKLLIAPSEPAAQLPALHP
FT                   STTASAVNHNLPSLSTALAGVTDVPPPASAGRLNGSSFGPLPPVSASSPPVSRTDPVWE
FT                   HQRLGQIPPPPPQVPPSPYSHLSPASSKDMSAMSSPASQQAYWRPPIKADITYLTSTYE
FT                   TAPQTAKSPATSYPTPTDQTPASTCDRSYNPPTHPNGAVSTGTYKCRHPGCTAAPFQTQ
FT                   YLLK"
     MTESYGLDEP RTPGLRPTEI DYLPKVSPPP FDTGDQSPKG GLPKHDAEAQ FPSSSRKLPE        60
     FQKPDSTEGN SVLIRHLEPN RPDIAWFETE HPLQRSTIAD DFPVLPKIIF GPEKSSVETK       120
     EPVDVVARKA LNLISPSEPK EGGPSVAPKD LPVAYKEPPR RPSIPVEEPA LKEEQQQQHT       180
     PPNIPHFSHL FQDGKLPDPE TRLGKLLIAP SEPAAQLPAL HPSTTASAVN HNLPSLSTAL       240
     AGVTDVPPPA SAGRLNGSSF GPLPPVSASS PPVSRTDPVW EHQRLGQIPP PPPQVPPSPY       300
     SHLSPASSKD MSAMSSPASQ QAYWRPPIKA DITYLTSTYE TAPQTAKSPA TSYPTPTDQT       360
     PASTCDRSYN PPTHPNGAVS TGTYKCRHPG CTAAPFQTQY LLK                         403
//

If you have problems or comments...

PBIL Back to PBIL home page