(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE50

ASPNC_1.PE50         Location/Qualifiers
FT   CDS             join(complement(141971..142179),complement(141666..141888))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111516" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874705"
FT                   /orf_name="An01g00560"
FT                   /product="Function: Sec11 from S. cerevisiae is a subunit
FT                   of the microsomal signal peptidase "
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43444.1"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG564658"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniParc:UPI0000EF9F42"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G0"
FT                   /transl_table=1
FT                   /translation="MWKGLSVLTNSPSPIVVVLSGSMEPAFQRGDLLFLRNTQPTLNVG
FT                   EIVVYQVKDKDIPIVHRVVRQFGEGSEAKLLTKGDNNIADDTELYARGQDYLDRDDVVG
FT                   SVFGYIPFVGYVTILLSEHPWLKTAMLGVMGLLVLLQRE"
     MWKGLSVLTN SPSPIVVVLS GSMEPAFQRG DLLFLRNTQP TLNVGEIVVY QVKDKDIPIV        60
     HRVVRQFGEG SEAKLLTKGD NNIADDTELY ARGQDYLDRD DVVGSVFGYI PFVGYVTILL       120
     SEHPWLKTAM LGVMGLLVLL QRE                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page