(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE53

ASPNC_1.PE53         Location/Qualifiers
FT   CDS             join(149971..150650,150735..150783)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234452" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874706"
FT                   /orf_name="An01g00610"
FT                   /product="Similarity to hypothetical protein BAC69773.1 -
FT                   Streptomyces avermitilis"
FT                   /protein_id="CAK43447.1"
FT                   /db_xref="HOGENOM:HBG654853"
FT                   /db_xref="InterPro:IPR019268"
FT                   /db_xref="UniParc:UPI0000EF9F45"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G3"
FT                   /transl_table=1
FT                   /translation="MTIPHYGVWIAQPTRYTAQTEEEDPKSPHIYLYFKDDSSSSKDYE
FT                   AAINVKSTGKDSRLVYWFDRSFSHPITEQLSNLDEGFHLLKSYSHRSRRHQESSSKLKG
FT                   LDFIRTKGLVNIESGAVLSEADTGPHNAVLEALEPILNDAISKKATVYIFGSSYGSGIH
FT                   DVHMNQGSAPSYENGIYEDGALLFSFGDGHWEAVFLAFASQEIPTDDKGEPEEGSKTLA
FT                   SILGQMLLREAVTFGTRFIA"
     MTIPHYGVWI AQPTRYTAQT EEEDPKSPHI YLYFKDDSSS SKDYEAAINV KSTGKDSRLV        60
     YWFDRSFSHP ITEQLSNLDE GFHLLKSYSH RSRRHQESSS KLKGLDFIRT KGLVNIESGA       120
     VLSEADTGPH NAVLEALEPI LNDAISKKAT VYIFGSSYGS GIHDVHMNQG SAPSYENGIY       180
     EDGALLFSFG DGHWEAVFLA FASQEIPTDD KGEPEEGSKT LASILGQMLL REAVTFGTRF       240
     IA                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page