(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE57

ASPNC_1.PE57         Location/Qualifiers
FT   CDS             complement(157927..158202)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959389"
FT                   /orf_name="An01g00650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43451.1"
FT                   /db_xref="UniParc:UPI0000EF9F49"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G7"
FT                   /transl_table=1
FT                   /translation="MSGNPERSNGKATLDLVDITLEHIDATARQDTLRKLFRSHVLQIC
FT                   GPEKVKAFNESNDKFKRHMVAYLAQKTVIGLFDSIAQELANELKKI"
     MSGNPERSNG KATLDLVDIT LEHIDATARQ DTLRKLFRSH VLQICGPEKV KAFNESNDKF        60
     KRHMVAYLAQ KTVIGLFDSI AQELANELKK I                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page