(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE58

ASPNC_1.PE58         Location/Qualifiers
FT   CDS             join(159669..160056,160111..160430,160569..160748,
FT                   160813..160857)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110318"
FT                   /orf_name="An01g00660"
FT                   /product="Similarity to hypothetical protein rfeF -
FT                   Aspergillus nidulans"
FT                   /protein_id="CAK32610.1"
FT                   /db_xref="HOGENOM:HBG330065"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniParc:UPI0000EF9F4A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G8"
FT                   /transl_table=1
FT                   /translation="MDPEWGDESEASTVGDEQEDTINEIVAEVIDQFLTEFSRQLGIRQ
FT                   PEDSSPPRSLEPKVPETEEEYREYVWSYIENKLRSYYQPGDQYVEEIVKSAAVRARSLT
FT                   QKYELKAETTPKLAIMALYDFVILCDDSKSMRKDRGTRIRALEETCQRVAEIASAVHEQ
FT                   DVYLRFLNNAEDRHLNKLSPNEIQGQMKKIKYSGLTRLGTVLRTKIVEPLIYDPVINGL
FT                   SAKPVITIVVTDGRPAGAVFLISRVGNDANAETFLSNLKMNEELQEMLYCCQDQLDERR
FT                   EVFRRAGKDGRYSSYLIELFVAALDSQAR"
     MDPEWGDESE ASTVGDEQED TINEIVAEVI DQFLTEFSRQ LGIRQPEDSS PPRSLEPKVP        60
     ETEEEYREYV WSYIENKLRS YYQPGDQYVE EIVKSAAVRA RSLTQKYELK AETTPKLAIM       120
     ALYDFVILCD DSKSMRKDRG TRIRALEETC QRVAEIASAV HEQDVYLRFL NNAEDRHLNK       180
     LSPNEIQGQM KKIKYSGLTR LGTVLRTKIV EPLIYDPVIN GLSAKPVITI VVTDGRPAGA       240
     VFLISRVGND ANAETFLSNL KMNEELQEML YCCQDQLDER REVFRRAGKD GRYSSYLIEL       300
     FVAALDSQAR                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page