(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE6

ASPNC_1.PE6          Location/Qualifiers
FT   CDS             join(12561..13089,13163..18111,18171..18281)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959384"
FT                   /orf_name="An01g00060"
FT                   /product="Catalytic activity: Acetyl-CoA + n Malonyl-CoA +
FT                   2n NADPH "
FT                   /function="fatty-acyl-CoA synthase activity"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK36857.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004321"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG325769"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR021186"
FT                   /db_xref="UniParc:UPI0000EF9EBD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B6"
FT                   /transl_table=1
FT                   /translation="MRPEIEQELAHTLLVELLAYQFASPVRWIETQDVILAEKRTERIV
FT                   EIGPADTLGGMARRTLASKYEAYDAATSVQRQILCYNKDAKEIYYDVDPVEEEEAQPSA
FT                   EAAASAPAAAPAGAPAVAAAPAAAPPPSAGPAAAIEDAPVTAVDVLRTLVAQKLKKSLS
FT                   DVPLSKAIKDLVGGKSTLQNEILGDLGKEFGSTPEKPEDTPLDELGASMQATFNGQLGK
FT                   QSSSLIARLVSSKMPGGFNITAVRKYLETRWGLGSGRQDGVLLLALTMEPPSRIGSEAE
FT                   AKSYLDDVANKYAASAGISLSAPAAGGDSGAGGGGMLMDPAAIDALTKDQRALFKQQLE
FT                   IIARYLKMDLRAGQKAYITSQESQKTLQAQLDLWQAEHGDFYASGIEPAFDALKARVYD
FT                   SSWNWARQDALSMYYDIIFGRLKVVDREIVSQCIRIMNRSNPLLLEFMQYHIDNCPTDR
FT                   GETYQLAKELGEQLIENCKEVLGVAPVYKDVAVPTGPQTTVDARGNIGYKEVPRASARK
FT                   LEHYVKQMAEGGPISEYSNRTKVQNDLRSVYKLIRRQHRLSKSSQLQFNALYKEVIRAL
FT                   SMNENQIMPQENGSGKKTGRNGVKRNGSPRAGKVETIPFLHLKKKSEHGWDYNKKLTGI
FT                   YLDVLESAARSGLTFQGKNVLMTGAGAGSIGAEVLQGLISGGAKVVVTTSRYSREVTEY
FT                   YQAMYARYGGRGSQLVVVPFNQGSKQDVEALVDYIYDSKKGLGWDLDFVVPFAAIPENG
FT                   REIDSIDSKSELAHRIMLTNLLRLLGCIKTQKQSNGFETRPAQVILPLSPNHGTFGNDG
FT                   LYSESKLALETLFNRWYSENWNNYLTICGAVIGWTRGTGLMSGNNMVAEGVEKLGVRTF
FT                   SQQEMAFNLLGLMAPAIVNLCQLDPVWADLNGGLQFIPDLKDLMTKLRTEIMETSDVRQ
FT                   AVIKETAIENKVVNGEDSEVLYKRVIAEPRANIKFQFPNLPNWEEDVKPLNDNLKGMVN
FT                   LDKVVVVTGFSEVGPWGNSRTRWEMEAYGKFSLEGCVEMAWIMGLIKHHNGPLKGKAYS
FT                   GWVDAKSGEPVDDKDVKPKYEKFILEHSGIRLIEPELFKGYDPKKKQLLQEIVIQEDLD
FT                   PFEASKETAEEFKREHGEKVEIFELPESGEYTVRLKKGATLLIPKALQFDRLVAGQIPT
FT                   GWDAKRYGIPDDIIEQVDPVTLFVLVCTAESLLSAGITDPYEFYKYVHLSEVGNCIGSG
FT                   IGGTHALRGMYKDRYLDKPLQKDILQESFINTMSAWVNMLLLSSTGPIKTPVGACATAV
FT                   ESVDIGYETIVEGKARVCFVGGFDDFQEEGSYEFANMKATSNAEDEFAHGRTPQEMSRP
FT                   TTTTRAGFMESQGCGMQLIMSAQLALDMGVPIYGIIALTTTATDKIGRSVPAPGQGVLT
FT                   TARENPGKFPSPLLDIKYRRRQLDLRKKQIKEWQESELLYLQEEAEAMKAQASDDSFDV
FT                   SGYLQERAQHIEREAIRQEKDAQYSLGNNFWKQDSRIAPLRGALATWGLTVDDIGVASF
FT                   HGTSTVANDKNESDVICQQMKHLGRKKGNALLGIFQKYLTGHPKGAAGAWMFNGCLQVL
FT                   ESGLVPGNRNADNVDKVMEKFDYIVYPSRSIQTDGINAFSVTSFGFGQKGAQVIGIHPK
FT                   YLYATLDRAQYQTYKAKVEARQKKAYRFFHNGLINNSIFVAKDKAPYEDAQQSKVFLNP
FT                   DYRVAADKKTSQLKFPAQPPKANDKGLESTKTMIESLAKANASEDSKVGVDVENIESFN
FT                   IENETFIERNFTASEQEYCQKAASPRSSFAGRWSAKEAVFKALGVSSKGAGAPLKDIEI
FT                   SSDSTGAPVVNLHGAAAEAAKQAGVKQVSVSISHSDTQAVAVAVSKF"
     MRPEIEQELA HTLLVELLAY QFASPVRWIE TQDVILAEKR TERIVEIGPA DTLGGMARRT        60
     LASKYEAYDA ATSVQRQILC YNKDAKEIYY DVDPVEEEEA QPSAEAAASA PAAAPAGAPA       120
     VAAAPAAAPP PSAGPAAAIE DAPVTAVDVL RTLVAQKLKK SLSDVPLSKA IKDLVGGKST       180
     LQNEILGDLG KEFGSTPEKP EDTPLDELGA SMQATFNGQL GKQSSSLIAR LVSSKMPGGF       240
     NITAVRKYLE TRWGLGSGRQ DGVLLLALTM EPPSRIGSEA EAKSYLDDVA NKYAASAGIS       300
     LSAPAAGGDS GAGGGGMLMD PAAIDALTKD QRALFKQQLE IIARYLKMDL RAGQKAYITS       360
     QESQKTLQAQ LDLWQAEHGD FYASGIEPAF DALKARVYDS SWNWARQDAL SMYYDIIFGR       420
     LKVVDREIVS QCIRIMNRSN PLLLEFMQYH IDNCPTDRGE TYQLAKELGE QLIENCKEVL       480
     GVAPVYKDVA VPTGPQTTVD ARGNIGYKEV PRASARKLEH YVKQMAEGGP ISEYSNRTKV       540
     QNDLRSVYKL IRRQHRLSKS SQLQFNALYK EVIRALSMNE NQIMPQENGS GKKTGRNGVK       600
     RNGSPRAGKV ETIPFLHLKK KSEHGWDYNK KLTGIYLDVL ESAARSGLTF QGKNVLMTGA       660
     GAGSIGAEVL QGLISGGAKV VVTTSRYSRE VTEYYQAMYA RYGGRGSQLV VVPFNQGSKQ       720
     DVEALVDYIY DSKKGLGWDL DFVVPFAAIP ENGREIDSID SKSELAHRIM LTNLLRLLGC       780
     IKTQKQSNGF ETRPAQVILP LSPNHGTFGN DGLYSESKLA LETLFNRWYS ENWNNYLTIC       840
     GAVIGWTRGT GLMSGNNMVA EGVEKLGVRT FSQQEMAFNL LGLMAPAIVN LCQLDPVWAD       900
     LNGGLQFIPD LKDLMTKLRT EIMETSDVRQ AVIKETAIEN KVVNGEDSEV LYKRVIAEPR       960
     ANIKFQFPNL PNWEEDVKPL NDNLKGMVNL DKVVVVTGFS EVGPWGNSRT RWEMEAYGKF      1020
     SLEGCVEMAW IMGLIKHHNG PLKGKAYSGW VDAKSGEPVD DKDVKPKYEK FILEHSGIRL      1080
     IEPELFKGYD PKKKQLLQEI VIQEDLDPFE ASKETAEEFK REHGEKVEIF ELPESGEYTV      1140
     RLKKGATLLI PKALQFDRLV AGQIPTGWDA KRYGIPDDII EQVDPVTLFV LVCTAESLLS      1200
     AGITDPYEFY KYVHLSEVGN CIGSGIGGTH ALRGMYKDRY LDKPLQKDIL QESFINTMSA      1260
     WVNMLLLSST GPIKTPVGAC ATAVESVDIG YETIVEGKAR VCFVGGFDDF QEEGSYEFAN      1320
     MKATSNAEDE FAHGRTPQEM SRPTTTTRAG FMESQGCGMQ LIMSAQLALD MGVPIYGIIA      1380
     LTTTATDKIG RSVPAPGQGV LTTARENPGK FPSPLLDIKY RRRQLDLRKK QIKEWQESEL      1440
     LYLQEEAEAM KAQASDDSFD VSGYLQERAQ HIEREAIRQE KDAQYSLGNN FWKQDSRIAP      1500
     LRGALATWGL TVDDIGVASF HGTSTVANDK NESDVICQQM KHLGRKKGNA LLGIFQKYLT      1560
     GHPKGAAGAW MFNGCLQVLE SGLVPGNRNA DNVDKVMEKF DYIVYPSRSI QTDGINAFSV      1620
     TSFGFGQKGA QVIGIHPKYL YATLDRAQYQ TYKAKVEARQ KKAYRFFHNG LINNSIFVAK      1680
     DKAPYEDAQQ SKVFLNPDYR VAADKKTSQL KFPAQPPKAN DKGLESTKTM IESLAKANAS      1740
     EDSKVGVDVE NIESFNIENE TFIERNFTAS EQEYCQKAAS PRSSFAGRWS AKEAVFKALG      1800
     VSSKGAGAPL KDIEISSDST GAPVVNLHGA AAEAAKQAGV KQVSVSISHS DTQAVAVAVS      1860
     KF                                                                     1862
//

If you have problems or comments...

PBIL Back to PBIL home page