(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE60

ASPNC_1.PE60         Location/Qualifiers
FT   CDS             join(164378..164425,164478..165590,165653..165985)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000166635" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959390"
FT                   /orf_name="An01g00680"
FT                   /product="Catalytic activity: Benzoate + NADPH + O2  "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK32612.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324782"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0000EF9F4C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H0"
FT                   /transl_table=1
FT                   /translation="MALNVTTYATIVTVLLLPVLLAIKRLYFHPLSRYDGPRLWALTRL
FT                   PYMLAFRSGRLAHDIKRFHDIYGDTVRVGPDEVSFLDPDCIKDIYSRRPNNPHYKALPK
FT                   DPIRQKPPQPGQPGDILDVEDDDHSRIRKAYAPAFSTQALNAQKPLVTSYVCKMVAQLK
FT                   SRANSTDPSKRIVDLQRWVTYCTFDIICSLSFGEDFGCLDNDNYHEWVGMVVNSVKGKV
FT                   QIAAFRFYPWLFNYLVKSLPKSAQLMVKRHQAMTNEKVQKRLHTAVDRPDFFSYLLKSK
FT                   NELTEPEMEINAATFIFAGSHTLQSSLTGILFHLLKNPEALARVAEEVRSSFPDEEDLD
FT                   ANKLSKLPLLDAAIKEGIRLTAPVPLGITRLVPRGGHTVCGQYFPEGSKVAYNLWAAGV
FT                   SPRNFADPTKFHLERWLNPDEGRFANDRRSAIQPFLQGPRDCIGQNLARLEMSLVIGYL
FT                   VYHFDFVLPNGREALGEWEDQETYAVWMKSPLMVELVAR"
     MALNVTTYAT IVTVLLLPVL LAIKRLYFHP LSRYDGPRLW ALTRLPYMLA FRSGRLAHDI        60
     KRFHDIYGDT VRVGPDEVSF LDPDCIKDIY SRRPNNPHYK ALPKDPIRQK PPQPGQPGDI       120
     LDVEDDDHSR IRKAYAPAFS TQALNAQKPL VTSYVCKMVA QLKSRANSTD PSKRIVDLQR       180
     WVTYCTFDII CSLSFGEDFG CLDNDNYHEW VGMVVNSVKG KVQIAAFRFY PWLFNYLVKS       240
     LPKSAQLMVK RHQAMTNEKV QKRLHTAVDR PDFFSYLLKS KNELTEPEME INAATFIFAG       300
     SHTLQSSLTG ILFHLLKNPE ALARVAEEVR SSFPDEEDLD ANKLSKLPLL DAAIKEGIRL       360
     TAPVPLGITR LVPRGGHTVC GQYFPEGSKV AYNLWAAGVS PRNFADPTKF HLERWLNPDE       420
     GRFANDRRSA IQPFLQGPRD CIGQNLARLE MSLVIGYLVY HFDFVLPNGR EALGEWEDQE       480
     TYAVWMKSPL MVELVAR                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page