(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE66

ASPNC_1.PE66         Location/Qualifiers
FT   CDS             <180928..181542
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806152"
FT                   /orf_name="An01g00740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43452.1"
FT                   /db_xref="UniParc:UPI0000EF9F6E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H6"
FT                   /transl_table=1
FT                   /translation="NTIALLSQTLTVILDIVEVGSSIGLYTVTGVFATVLPVLGAVLAV
FT                   LGVVMMLINLFVNLFGGSPPPDPVQEFIDHVAKGLVGGFENAPPPKLDYTIPSVIYESG
FT                   EVTGITIKGENTTNDEISIPNARIVVNSGSDDVCLFSTDDFELVEDTDTDKDSDKHLYV
FT                   TPNSTAEGTLSSSVLGDETEYHEFDLVVGGKKRIRRTVCTN"
     NTIALLSQTL TVILDIVEVG SSIGLYTVTG VFATVLPVLG AVLAVLGVVM MLINLFVNLF        60
     GGSPPPDPVQ EFIDHVAKGL VGGFENAPPP KLDYTIPSVI YESGEVTGIT IKGENTTNDE       120
     ISIPNARIVV NSGSDDVCLF STDDFELVED TDTDKDSDKH LYVTPNSTAE GTLSSSVLGD       180
     ETEYHEFDLV VGGKKRIRRT VCTN                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page