(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE73

ASPNC_1.PE73         Location/Qualifiers
FT   CDS             join(complement(193845..194194),complement(193759..193792))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959656"
FT                   /orf_name="An01g00810"
FT                   /product="Similarity to androgen receptor A hARa -Homo
FT                   sapiens"
FT                   /function="receptor activity"
FT                   /protein_id="CAK43459.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="UniParc:UPI0000EF9F74"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I3"
FT                   /transl_table=1
FT                   /translation="MADDPDVSQWQFSTTWLYFPCTEEYQNRAEQFQRAIENIDSLTYA
FT                   IYHYNPAIPPTMRGVLLAVYHPLDYGTASILAIARGDLVSYRNAAAGQPGGMGPSQSTI
FT                   YLSLNEDDDMDTSEDAMMSTDIQ"
     MADDPDVSQW QFSTTWLYFP CTEEYQNRAE QFQRAIENID SLTYAIYHYN PAIPPTMRGV        60
     LLAVYHPLDY GTASILAIAR GDLVSYRNAA AGQPGGMGPS QSTIYLSLNE DDDMDTSEDA       120
     MMSTDIQ                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page