(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE77

ASPNC_1.PE77         Location/Qualifiers
FT   CDS             join(199947..200369,200419..200533,200628..201020,
FT                   201084..201437,201508..201911)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875699"
FT                   /orf_name="An01g00850"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43463.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9F78"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I7"
FT                   /transl_table=1
FT                   /translation="MVVSQSVVGRTNAEKPHGLMGMLKNPYVFMTCAFASLGCIMYGYD
FT                   QGVMSPVLVMENFENHFPYFMGSTVQGWLVASLELGAWAGALFNGYLADRISRKYSMMV
FT                   AVVIFTLGSSLQAGAQKPSYFFAGRIVGGIGIGMFSQVIPLYQAEIAPPELRGSLVSLQ
FT                   QLSITIGTSIAFWLDYGIANPYLADGTYNAAQNHGHTCLGQKTIAWRLPLALQILFAWI
FT                   LFFGMFFFPFSPRWLMSKHREEEATAALSKLRRLPPNDPLLRAEILEIKAAVLFDEESE
FT                   AEAIRQGGKLAPWKMLFAPNMFKRLVLGCGAMIFQQFTGINAVLYYAPQIFSSFGFSST
FT                   KQTLLATGVTGILQIIFTLPAVLLLDKFGRKTFLITGAVGMFCCHIVVAIVEGLYEDNW
FT                   NLNMGLDKPQGWVAIAFIWLFAVNFAYSWGPVTWVLAQEIFPNSTRSRGVSIVASTNWM
FT                   FNFVIGLTTKDMLKSMKYGTYIFFAIFSALGGLFIWKFAPETKDKTLEELDIFFGGGMD
FT                   SIAEADRQRMERIYDSLGLSGVKEVGDLVVEKEKGEITGEVVEMS"
     MVVSQSVVGR TNAEKPHGLM GMLKNPYVFM TCAFASLGCI MYGYDQGVMS PVLVMENFEN        60
     HFPYFMGSTV QGWLVASLEL GAWAGALFNG YLADRISRKY SMMVAVVIFT LGSSLQAGAQ       120
     KPSYFFAGRI VGGIGIGMFS QVIPLYQAEI APPELRGSLV SLQQLSITIG TSIAFWLDYG       180
     IANPYLADGT YNAAQNHGHT CLGQKTIAWR LPLALQILFA WILFFGMFFF PFSPRWLMSK       240
     HREEEATAAL SKLRRLPPND PLLRAEILEI KAAVLFDEES EAEAIRQGGK LAPWKMLFAP       300
     NMFKRLVLGC GAMIFQQFTG INAVLYYAPQ IFSSFGFSST KQTLLATGVT GILQIIFTLP       360
     AVLLLDKFGR KTFLITGAVG MFCCHIVVAI VEGLYEDNWN LNMGLDKPQG WVAIAFIWLF       420
     AVNFAYSWGP VTWVLAQEIF PNSTRSRGVS IVASTNWMFN FVIGLTTKDM LKSMKYGTYI       480
     FFAIFSALGG LFIWKFAPET KDKTLEELDI FFGGGMDSIA EADRQRMERI YDSLGLSGVK       540
     EVGDLVVEKE KGEITGEVVE MS                                                562
//

If you have problems or comments...

PBIL Back to PBIL home page