(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE84

ASPNC_1.PE84         Location/Qualifiers
FT   CDS             219994..220749
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875702"
FT                   /orf_name="An01g00920"
FT                   /product="Similarity to hypothetical lysogenic protein
FT                   CAD54907.1 - Bacteriophage P2-EC58 "
FT                   /protein_id="CAK43470.1"
FT                   /db_xref="UniParc:UPI0000EF9D4C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J4"
FT                   /transl_table=1
FT                   /translation="MSAGITAIVTLHSDRLKRHSESEKLVAEYRDPLLLASMELQSRLY
FT                   NILEQDFLCYYENKARRDLVDVYTAFLIGQFFSWTYILRRQVQFLRFSSNKSNQKLSRA
FT                   IEAIQKSFSTDMYGKDDSDFMLWRGEQLAIGEIMTVSDDGELFCLQYSQFIQKFKSADA
FT                   PFKDYFNPITEGITALVNRRSTHHPSQHLPAGRLRRVQHFILDLIDVLDPHYLGKASAR
FT                   SQRVYSAPCCDCSECRREAGSYGTDSGTS"
     MSAGITAIVT LHSDRLKRHS ESEKLVAEYR DPLLLASMEL QSRLYNILEQ DFLCYYENKA        60
     RRDLVDVYTA FLIGQFFSWT YILRRQVQFL RFSSNKSNQK LSRAIEAIQK SFSTDMYGKD       120
     DSDFMLWRGE QLAIGEIMTV SDDGELFCLQ YSQFIQKFKS ADAPFKDYFN PITEGITALV       180
     NRRSTHHPSQ HLPAGRLRRV QHFILDLIDV LDPHYLGKAS ARSQRVYSAP CCDCSECRRE       240
     AGSYGTDSGT S                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page