(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE90

ASPNC_1.PE90         Location/Qualifiers
FT   CDS             complement(233314..233586)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875705"
FT                   /orf_name="An01g00990"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g12970 - Aspergillus niger"
FT                   /protein_id="CAK43476.1"
FT                   /db_xref="UniParc:UPI0000EF9D52"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K0"
FT                   /transl_table=1
FT                   /translation="MSRVIPKRDKKRPQDRNAQRATRQRTKDCLALLELQVSQLQGGAD
FT                   KALSDELRQMRKERDELGTLADDLVTIAEATKSALESSNNEAAQT"
     MSRVIPKRDK KRPQDRNAQR ATRQRTKDCL ALLELQVSQL QGGADKALSD ELRQMRKERD        60
     ELGTLADDLV TIAEATKSAL ESSNNEAAQT                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page