(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE93

ASPNC_1.PE93         Location/Qualifiers
FT   CDS             join(238713..238872,238928..242046)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000193108" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806402"
FT                   /orf_name="An01g01020"
FT                   /product="Similarity to protein SEQ ID NO:628 from patent
FT                   WO200222660-A2 - Homo sapiens"
FT                   /function="NAD+ ADP-ribosyltransferase activity "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAK43479.1"
FT                   /db_xref="GO:0003950"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG324517"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR012317"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000EF9D6B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K3"
FT                   /transl_table=1
FT                   /translation="MPWKLFRKDLSDVCLRGRFPRLSHLRLGDEDSTIAFTYSFQPSMH
FT                   IEFMVSILDATEYPDNHSYFAFAVTDNIPPAVSAILETVQCKFNGCSLETFLEGFCNYL
FT                   DQAALGREPRASSPIDDDFDAISDGEDMDWDEYPDAPQMDHSVDMKQLRTDLRAAKSAG
FT                   FKVGYLGDLEGSFIVSISCRIASLGISQDAMQMWDVCPTHFIVLLLYYPRGYRRLDHIV
FT                   SQSQTAPSPVRMYVGFCDRYKPTAVSIPETHQEFSGLGVSSSTPKSALKSSFITDPLET
FT                   LLNDRFLSIVQDRLRHGFSWTGAEIFYNDAQGKKLDTKDSKLPKYFVPEEWAKFTPGFV
FT                   KADDLSQHTAHQLSLPLIAMQYTLRRFVKCTEFCLNCHCKIDAGFEALKPYVCSSPLCL
FT                   YQYMQLGMGPKLEWEIVTQPYVVDMLVSFAYARAAQGQLTDLPSGLGMKVASTGSTLPS
FT                   WTARLDAAKMTLLAQKPHNLKVGEWILIKLANASDLPSTVSSLCSTVLQVHDQSLVEIS
FT                   QPISVGYWADPQDSLSDGLDVQVVPFRVDFDSLAGDLKQKAVMLLLDTLPDVFSMKYFI
FT                   ESSAPEHKALASWHGTICPSALYVLRWILASNRSCIVHDDNPEHQVTGMHNYMQFRLAQ
FT                   GSPDKEARFVQELNNSSNTEFPTLFAWHGSPIYNWHSILREGLNFAQQLNGRAYGDGVY
FT                   MAKDLEVSRIYCSRGSMSGAKWSRSKLDITSAISLNEVVNSPTKFKLTKPYYVVTQLDW
FT                   IQSRYLFISGGGIKAQGENKNKPSKVYKQHPDWTARGPGNEPVSIPISALGTRQSQSHK
FT                   NKDDSNGLATGHRQKKRKASTKGVCGPSESSSTTDPNDDTEIEDLRLLDSDSDGDVIGK
FT                   SRRVDASKSSHNLTRGSKTDFQPGTLQAHSFKLLGPPSYATTTATKSLQRHLKATLRIQ
FT                   DREPLHEIGWYVDPTLINNVYQWIVEFHSFDPSLPLAQDLKQKGLTSVVMEMRFPPQFP
FT                   MSPPFIRVVRPRFMSFQQRGGGHVTAGGAMCMELLTSSGWLPTSSIDSVFLQVRMALCS
FT                   TEPWPARIERDGDYPFSEAVSAYRRACQAHGWKVPDDFNRIEAA"
     MPWKLFRKDL SDVCLRGRFP RLSHLRLGDE DSTIAFTYSF QPSMHIEFMV SILDATEYPD        60
     NHSYFAFAVT DNIPPAVSAI LETVQCKFNG CSLETFLEGF CNYLDQAALG REPRASSPID       120
     DDFDAISDGE DMDWDEYPDA PQMDHSVDMK QLRTDLRAAK SAGFKVGYLG DLEGSFIVSI       180
     SCRIASLGIS QDAMQMWDVC PTHFIVLLLY YPRGYRRLDH IVSQSQTAPS PVRMYVGFCD       240
     RYKPTAVSIP ETHQEFSGLG VSSSTPKSAL KSSFITDPLE TLLNDRFLSI VQDRLRHGFS       300
     WTGAEIFYND AQGKKLDTKD SKLPKYFVPE EWAKFTPGFV KADDLSQHTA HQLSLPLIAM       360
     QYTLRRFVKC TEFCLNCHCK IDAGFEALKP YVCSSPLCLY QYMQLGMGPK LEWEIVTQPY       420
     VVDMLVSFAY ARAAQGQLTD LPSGLGMKVA STGSTLPSWT ARLDAAKMTL LAQKPHNLKV       480
     GEWILIKLAN ASDLPSTVSS LCSTVLQVHD QSLVEISQPI SVGYWADPQD SLSDGLDVQV       540
     VPFRVDFDSL AGDLKQKAVM LLLDTLPDVF SMKYFIESSA PEHKALASWH GTICPSALYV       600
     LRWILASNRS CIVHDDNPEH QVTGMHNYMQ FRLAQGSPDK EARFVQELNN SSNTEFPTLF       660
     AWHGSPIYNW HSILREGLNF AQQLNGRAYG DGVYMAKDLE VSRIYCSRGS MSGAKWSRSK       720
     LDITSAISLN EVVNSPTKFK LTKPYYVVTQ LDWIQSRYLF ISGGGIKAQG ENKNKPSKVY       780
     KQHPDWTARG PGNEPVSIPI SALGTRQSQS HKNKDDSNGL ATGHRQKKRK ASTKGVCGPS       840
     ESSSTTDPND DTEIEDLRLL DSDSDGDVIG KSRRVDASKS SHNLTRGSKT DFQPGTLQAH       900
     SFKLLGPPSY ATTTATKSLQ RHLKATLRIQ DREPLHEIGW YVDPTLINNV YQWIVEFHSF       960
     DPSLPLAQDL KQKGLTSVVM EMRFPPQFPM SPPFIRVVRP RFMSFQQRGG GHVTAGGAMC      1020
     MELLTSSGWL PTSSIDSVFL QVRMALCSTE PWPARIERDG DYPFSEAVSA YRRACQAHGW      1080
     KVPDDFNRIE AA                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page