(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE94

ASPNC_1.PE94         Location/Qualifiers
FT   CDS             complement(242490..242972)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959661"
FT                   /orf_name="An01g01030"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An16g05360 - Aspergillus niger"
FT                   /protein_id="CAK43480.1"
FT                   /db_xref="UniParc:UPI0000EF9D6C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K4"
FT                   /transl_table=1
FT                   /translation="MTHYPVYIIRTHLAMPGPDLPSPRYHTAIFVETDPVTGSGTIHEV
FT                   TGDITSPEGMYYESKLAPQPESVENFFSRTLLGMTDAAHYPNSWDNVLREIPAPPQQKA
FT                   FNVKRMKTEPFKRLSPLEFYEAGEERRPLVKCTEWVVDKAIPALRKAGLLQSSISA"
     MTHYPVYIIR THLAMPGPDL PSPRYHTAIF VETDPVTGSG TIHEVTGDIT SPEGMYYESK        60
     LAPQPESVEN FFSRTLLGMT DAAHYPNSWD NVLREIPAPP QQKAFNVKRM KTEPFKRLSP       120
     LEFYEAGEER RPLVKCTEWV VDKAIPALRK AGLLQSSISA                             160
//

If you have problems or comments...

PBIL Back to PBIL home page