(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE97

ASPNC_1.PE97         Location/Qualifiers
FT   CDS             join(complement(248608..248908),complement(248200..248528))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875707"
FT                   /orf_name="An01g01060"
FT                   /product="Complex: Forms a heterodimer with the spU2AF59
FT                   large subunit"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43483.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG525917"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EF9D6F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K7"
FT                   /transl_table=1
FT                   /translation="MANYLASIFGTEQDKVNCSFYYKIGACRHGDRCSRKHVKPSYSQT
FT                   ILMPNMYQNPAYDPKSKMNPSQLQNHFDAFYEDVWCEMCKYGELEELVVCDNNNDHLIG
FT                   NVYARFKYEEDAQAACDALNSRWYAARPIYCELSPVTDFREACCRLNSGEGCVRGGFCN
FT                   FIHRKDPSNELDRDLRLSTKKWLKERGRDARSVSRSPSPEPTRRRY"
     MANYLASIFG TEQDKVNCSF YYKIGACRHG DRCSRKHVKP SYSQTILMPN MYQNPAYDPK        60
     SKMNPSQLQN HFDAFYEDVW CEMCKYGELE ELVVCDNNND HLIGNVYARF KYEEDAQAAC       120
     DALNSRWYAA RPIYCELSPV TDFREACCRL NSGEGCVRGG FCNFIHRKDP SNELDRDLRL       180
     STKKWLKERG RDARSVSRSP SPEPTRRRY                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page