(data stored in ACNUC7820 zone)

EMBL: AY073016

AY073016             Location/Qualifiers
FT   CDS             1..930
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR139-1"
FT                   /db_xref="GOA:Q8VGX5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL60679.1"
FT                   /translation="MEPRNNTHILEFFLLGFSQDPNLQPVICGLFLSMYLITVVGNLLI
FT                   ILTIISDANLHTPMYFFLSNLSFVDICFVSTTVPKMLVNIQTKRKSISYADCITQMYFF
FT                   LIFVELDNFLLAVMAYDRYVAICHPLHYTGIMNRRLCGFLVLVCWIVSVLHALLQSMMV
FT                   LRLSFCTDLEIPHFFCELNQVAQLTCSDTFLNDVVMYFALVLLAIVPLFGILYSYSKIV
FT                   SSIRAMSTVQGKYKAFSTCASHLSVVSLFYFTGLGVYLSSAVSHSSQASATASVMYTVV
FT                   TPMLNPFIYSLRNKDVKGALKRLLGVKL"
     MEPRNNTHIL EFFLLGFSQD PNLQPVICGL FLSMYLITVV GNLLIILTII SDANLHTPMY        60
     FFLSNLSFVD ICFVSTTVPK MLVNIQTKRK SISYADCITQ MYFFLIFVEL DNFLLAVMAY       120
     DRYVAICHPL HYTGIMNRRL CGFLVLVCWI VSVLHALLQS MMVLRLSFCT DLEIPHFFCE       180
     LNQVAQLTCS DTFLNDVVMY FALVLLAIVP LFGILYSYSK IVSSIRAMST VQGKYKAFST       240
     CASHLSVVSL FYFTGLGVYL SSAVSHSSQA SATASVMYTV VTPMLNPFIY SLRNKDVKGA       300
     LKRLLGVKL                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page