(data stored in ACNUC27637 zone)

EMBL: AY099530.NCBP2

AY099530.NCBP2       Location/Qualifiers
FT   CDS             61..528
FT                   /codon_start=1
FT                   /gene="ncbp2"
FT                   /product="nuclear cap binding protein subunit 2"
FT                   /db_xref="GOA:Q8JGR6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR027157"
FT                   /db_xref="InterPro:IPR034148"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8JGR6"
FT                   /db_xref="ZFIN:ZDB-GENE-020419-31"
FT                   /protein_id="AAM28218.1"
FT                   /translation="MSIKLNALFSDFYVDVSQYRDQHFKGNRYEQEKLLKQSATLYVGN
FT                   LSFYTTEEQVHVLFAKCGDVKRIIIGLDKIKKTACGFCFVEYYTRADAENAMRFVNGTR
FT                   LDDRIIRTDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKMVQKS"
     MSIKLNALFS DFYVDVSQYR DQHFKGNRYE QEKLLKQSAT LYVGNLSFYT TEEQVHVLFA        60
     KCGDVKRIII GLDKIKKTAC GFCFVEYYTR ADAENAMRFV NGTRLDDRII RTDWDAGFKE       120
     GRQYGRGKSG GQVRDEYRQD YDPARGGYGK MVQKS                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page