(data stored in ACNUC15260 zone)

EMBL: AY317653

AY317653             Location/Qualifiers
FT   CDS             1..933
FT                   /codon_start=1
FT                   /gene="Olfr45"
FT                   /product="olfactory receptor Olfr45"
FT                   /db_xref="GOA:Q7TRT0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRT0"
FT                   /protein_id="AAP71035.1"
FT                   /translation="MLRLNQTEVTEFVLEGFSEHPDLRLFLIGCFLTLYIMALMGNILI
FT                   IALVTSSTGLHNPMYFFLCNLATTDILCTSSVIPKALVGLVSEENTISFKECMSQLFFL
FT                   AWSASSELLLLTVMAYDRYVAICCPLHYSSRMSPQMCGALAMGVWSISAVNASVHTGLM
FT                   TRLSFCGPKVITHFFCEIPPLLLLSCSPTYVNTIMTLLGDSFFGGVNFVLTLLSYGCII
FT                   ASILRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSIV
FT                   SPTLNPLIYTLRNKDVKLALGRILASFSH"
     MLRLNQTEVT EFVLEGFSEH PDLRLFLIGC FLTLYIMALM GNILIIALVT SSTGLHNPMY        60
     FFLCNLATTD ILCTSSVIPK ALVGLVSEEN TISFKECMSQ LFFLAWSASS ELLLLTVMAY       120
     DRYVAICCPL HYSSRMSPQM CGALAMGVWS ISAVNASVHT GLMTRLSFCG PKVITHFFCE       180
     IPPLLLLSCS PTYVNTIMTL LGDSFFGGVN FVLTLLSYGC IIASILRMRS AEGKRKAFST       240
     CSSHLIVVSV YYSSVFCAYV SPASSYSPER SKVTSVLYSI VSPTLNPLIY TLRNKDVKLA       300
     LGRILASFSH                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page