(data stored in ACNUC7820 zone)

EMBL: AY318012

AY318012             Location/Qualifiers
FT   CDS             1..945
FT                   /codon_start=1
FT                   /gene="Olfr836"
FT                   /product="olfactory receptor Olfr836"
FT                   /db_xref="GOA:Q7TRG6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030670"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRG6"
FT                   /protein_id="AAP71322.1"
FT                   /translation="MEVENKSVVFDIFLHGLTDDTELQPFIFGLFLCMYLITIFGNLLI
FT                   ILAIICDSHLHTPMYFFLCHLAFNDMYLISITVPKMLVNIQTQDQRITFAGCLSQGCFV
FT                   AVCTIFECFLLGIMAYDRFIAICYPLRYTVLMNPCFCVILTLISLFFSIVNGLLHSLMV
FT                   LHLSFCTDLEILHFFCEIAQILKLACSDSLINNILIFVTSSIFAGVPLCGIIFSYVHIV
FT                   STVLKMPSLEGKYKAFSTCGSHLSVVSLFYGTGFGVYISSNVIDSPKKIAMASVMYSIV
FT                   PPMMNPFIYSMRNRNMKEALKKVIGRKLLFSDV"
     MEVENKSVVF DIFLHGLTDD TELQPFIFGL FLCMYLITIF GNLLIILAII CDSHLHTPMY        60
     FFLCHLAFND MYLISITVPK MLVNIQTQDQ RITFAGCLSQ GCFVAVCTIF ECFLLGIMAY       120
     DRFIAICYPL RYTVLMNPCF CVILTLISLF FSIVNGLLHS LMVLHLSFCT DLEILHFFCE       180
     IAQILKLACS DSLINNILIF VTSSIFAGVP LCGIIFSYVH IVSTVLKMPS LEGKYKAFST       240
     CGSHLSVVSL FYGTGFGVYI SSNVIDSPKK IAMASVMYSI VPPMMNPFIY SMRNRNMKEA       300
     LKKVIGRKLL FSDV                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page