(data stored in ACNUC7820 zone)

EMBL: AY375030

AY375030             Location/Qualifiers
FT   CDS             1..927
FT                   /codon_start=1
FT                   /gene="Olfr128"
FT                   /product="olfactory receptor 128"
FT                   /db_xref="GOA:Q7TRJ1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2177511"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRJ1"
FT                   /protein_id="AAQ77056.1"
FT                   /translation="MTPRNMTTMSGFLLMGFSDNHELQILQALLFLLTYLLGSAGNFII
FT                   ITITTLDPQLQSPMYYFLKHLSILDLSSLSVTVPQYVDSSLARSGYISYGQCMLQIFFF
FT                   TGLAWSEVALLTVMSYDRYVAICLPLHYEVIMSPRKCTWAVAAVWLSGGISGTLFTAST
FT                   LSIRFCGHKIIHQFFCDIPQLLKLSCSNDDFGLLKVSTFIAVMGFACFMGIAFSYGQIF
FT                   STVLRMPSAEGRSKVFSTCLPHLFVVSFFLSTGICAYLKPTSDSPTTLDFMLSIFYTVL
FT                   PPTLNPVIYSLRNQSLKRAIKKLLLSE"
     MTPRNMTTMS GFLLMGFSDN HELQILQALL FLLTYLLGSA GNFIIITITT LDPQLQSPMY        60
     YFLKHLSILD LSSLSVTVPQ YVDSSLARSG YISYGQCMLQ IFFFTGLAWS EVALLTVMSY       120
     DRYVAICLPL HYEVIMSPRK CTWAVAAVWL SGGISGTLFT ASTLSIRFCG HKIIHQFFCD       180
     IPQLLKLSCS NDDFGLLKVS TFIAVMGFAC FMGIAFSYGQ IFSTVLRMPS AEGRSKVFST       240
     CLPHLFVVSF FLSTGICAYL KPTSDSPTTL DFMLSIFYTV LPPTLNPVIY SLRNQSLKRA       300
     IKKLLLSE                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page