(data stored in ACNUC14238 zone)

EMBL: AY953023

AY953023             Location/Qualifiers
FT   CDS             <1..>2118
FT                   /codon_start=1
FT                   /product="smooth muscle myosin heavy chain, alternative
FT                   isoform B, S1 region"
FT                   /note="contractile protein; alternatively spliced"
FT                   /db_xref="GOA:Q63862"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002928"
FT                   /db_xref="InterPro:IPR027401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63862"
FT                   /protein_id="AAX51987.1"
FT                   /translation="KKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTK
FT                   KVIQYLAVVASSHKGKKDSSITQGPSFAYGELEKQLLQANPILEAFGNAKTVKNDNSSR
FT                   FGKFIRINFDVTGYIVGANIETYLLEKSRAIRHARDERTFHIFYYLIAGAKEKMRNDLL
FT                   LESFNSYTFLSNGFVPIPAAQDDEMFQETLEAMSIMGFSEEEQLAILKVVSSVLQLGNI
FT                   VFKKERNTDQASMPDNTAAQKVCHLVGINVTDFTRAILTPRIKVGRDVVQKAQTKEQAD
FT                   FAIEALAKATYERLFRWILSRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCIN
FT                   YTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLD
FT                   EECWFPKATDKSFVEKLCSEQGNHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKN
FT                   MDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVG
FT                   QLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQ
FT                   GFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRT
FT                   GVLAHLEEERDLKITDVIMAFQAMCRGYLARKAFTKRQQQLTASKVIQRNCAAYLKLRN
FT                   WQWWRLFTKVKP"
     KKRHEMPPHI YAIADTAYRS MLQDREDQSI LCTGESGAGK TENTKKVIQY LAVVASSHKG        60
     KKDSSITQGP SFAYGELEKQ LLQANPILEA FGNAKTVKND NSSRFGKFIR INFDVTGYIV       120
     GANIETYLLE KSRAIRHARD ERTFHIFYYL IAGAKEKMRN DLLLESFNSY TFLSNGFVPI       180
     PAAQDDEMFQ ETLEAMSIMG FSEEEQLAIL KVVSSVLQLG NIVFKKERNT DQASMPDNTA       240
     AQKVCHLVGI NVTDFTRAIL TPRIKVGRDV VQKAQTKEQA DFAIEALAKA TYERLFRWIL       300
     SRVNKALDKT HRQGASFLGI LDIAGFEIFE VNSFEQLCIN YTNEKLQQLF NHTMFILEQE       360
     EYQREGIEWN FIDFGLDLQP CIELIERPNN PPGVLALLDE ECWFPKATDK SFVEKLCSEQ       420
     GNHPKFQKPK QLKDKTEFSI IHYAGKVDYN ASAWLTKNMD PLNDNVTSLL NASSDKFVAD       480
     LWKDVDRIVG LDQMAKMTES SLPSASKTKK GMFRTVGQLY KEQLGKLMTT LRNTTPNFVR       540
     CIIPNHEKRS GKLDAFLVLE QLRCNGVLEG IRICRQGFPN RIVFQEFRQR YEILAANAIP       600
     KGFMDGKQAC ILMIKALELD PNLYRIGQSK IFFRTGVLAH LEEERDLKIT DVIMAFQAMC       660
     RGYLARKAFT KRQQQLTASK VIQRNCAAYL KLRNWQWWRL FTKVKP                      706
//

If you have problems or comments...

PBIL Back to PBIL home page