(data stored in ACNUC7421 zone)

EMBL: BA000007.ACPH

BA000007.ACPH        Location/Qualifiers
FT   CDS             complement(487968..488549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="ECs_0455"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33878"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33878"
FT                   /db_xref="GOA:Q8XE96"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE96"
FT                   /protein_id="BAB33878.1"
FT                   /translation="MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMH
FT                   RRIDVLTDNLPEVREAREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCY
FT                   AREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSW
FT                   YDLDAHYAALETRFWQFYPRMMAQASRKAL"
     MNFLAHLHLA HLAESSLSGN LLADFVRGNP EESFPPDVVA GIHMHRRIDV LTDNLPEVRE        60
     AREWFRSETR RVAPITLDVM WDHFLSRHWS QLSPDFPLQE FVCYAREQVM TILPDSPPRF       120
     INLNNYLWSE QWLVRYRDMD FIQNVLNGMA SRRPRLDALR DSWYDLDAHY AALETRFWQF       180
     YPRMMAQASR KAL                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page