(data stored in ACNUC7421 zone)

EMBL: BA000007.ADK

BA000007.ADK         Location/Qualifiers
FT   CDS             563011..563715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="ECs_0527"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33950"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33950"
FT                   /db_xref="GOA:P69442"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69442"
FT                   /protein_id="BAB33950.2"
FT                   /translation="MVVSFIAFSKNSTHFKGIFAMRIILLGAPGAGKGTQAQFIMEKYG
FT                   IPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLD
FT                   GFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVE
FT                   GKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPV
FT                   AEVRADLEKILG"
     MVVSFIAFSK NSTHFKGIFA MRIILLGAPG AGKGTQAQFI MEKYGIPQIS TGDMLRAAVK        60
     SGSELGKQAK DIMDAGKLVT DELVIALVKE RIAQEDCRNG FLLDGFPRTI PQADAMKEAG       120
     INVDYVLEFD VPDELIVDRI VGRRVHAPSG RVYHVKFNPP KVEGKDDVTG EELTTRKDDQ       180
     EETVRKRLVE YHQMTAPLIG YYSKEAEAGN TKYAKVDGTK PVAEVRADLE KILG             234
//

If you have problems or comments...

PBIL Back to PBIL home page