(data stored in ACNUC7421 zone)

EMBL: BA000007.AFUC

BA000007.AFUC        Location/Qualifiers
FT   CDS             complement(438140..439186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuC"
FT                   /locus_tag="ECs_0413"
FT                   /product="ferric transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33836"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33836"
FT                   /db_xref="GOA:Q7AH43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AH43"
FT                   /protein_id="BAB33836.2"
FT                   /translation="MSQKNFVELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGK
FT                   TTILRLVAGLEKPSEGQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLK
FT                   MLGVSRSEVKQRVKEALAMVDLEGFEDRYVDQISGGQQQRVALARALILKPKVLLFDEP
FT                   LSNLDANLRRSMRDKIRELQKQFNITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQ
FT                   DLYRQPASRFMASFMGDANLFPANFSEEYVDIYGYRLPRAAHFPVQGSGTVGVRPEAIT
FT                   LSNHGEESQRCVIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQPDIGEHYYLEIHPYG
FT                   MFVLADAA"
     MSQKNFVELR NVTKRFGSNT VIDNINLTIP QGQMVTLLGP SGCGKTTILR LVAGLEKPSE        60
     GQIFIDGEDV THRSIQQRDI CMVFQSYALF PHMSLGENVG YGLKMLGVSR SEVKQRVKEA       120
     LAMVDLEGFE DRYVDQISGG QQQRVALARA LILKPKVLLF DEPLSNLDAN LRRSMRDKIR       180
     ELQKQFNITS LYVTHDQSEA FAVSDTVLVM NKGHIMQIGS PQDLYRQPAS RFMASFMGDA       240
     NLFPANFSEE YVDIYGYRLP RAAHFPVQGS GTVGVRPEAI TLSNHGEESQ RCVIRHVAYM       300
     GPQYEVTVEW HGQEILLQVN ATRLQPDIGE HYYLEIHPYG MFVLADAA                    348
//

If you have problems or comments...

PBIL Back to PBIL home page