(data stored in ACNUC7421 zone)

EMBL: BA000007.AMPE

BA000007.AMPE        Location/Qualifiers
FT   CDS             123771..124625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="ECs_0115"
FT                   /product="ampicillin resistance inner membrane protein
FT                   AmpE"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33538"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33538"
FT                   /db_xref="GOA:Q8X970"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X970"
FT                   /protein_id="BAB33538.1"
FT                   /translation="MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLG
FT                   MTIIAMGVTFLLLRALQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSH
FT                   ARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLM
FT                   GYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWF
FT                   ASLGDFRTSQYQVLTRLAQFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYG
FT                   ALV"
     MTLFTTLLVL IFERLFKLGE HWQLDHRLEA FFRRVKHFSL GRTLGMTIIA MGVTFLLLRA        60
     LQGVLFNVPT LLVWLLIGLL CIGAGKVRLH YHAYLTAASR NDSHARATMA GELTMIHGVP       120
     AGCDEREYLR ELQNALLWIN FRFYLAPLFW LIVGGTWGPV TLMGYAFLRA WQYWLARYQT       180
     PHHRLQSGID AVLHVLDWVP VRLAGVVYAL IGHGEKALPA WFASLGDFRT SQYQVLTRLA       240
     QFSLAREPHV DKVETPKAAV SMAKKTSFVV VVVIALLTIY GALV                        284
//

If you have problems or comments...

PBIL Back to PBIL home page