(data stored in ACNUC7421 zone)

EMBL: BA000007.APAG

BA000007.APAG        Location/Qualifiers
FT   CDS             complement(56205..56582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="ECs_0055"
FT                   /product="CO2+/MG2+ efflux protein ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33478"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33478"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62674"
FT                   /protein_id="BAB33478.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDE
FT                   NGVPFSIDIPVFRLAVPTLIH"
     MINSPRVCIQ VQSVYIEAQS SPDNERYVFA YTVTIRNLGR APVQLLGRYW LITNGNGRET        60
     EVQGEGVVGV QPLIAPGEEY QYTSGAIIET PLGTMQGHYE MIDENGVPFS IDIPVFRLAV       120
     PTLIH                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page