(data stored in ACNUC7421 zone)

EMBL: BA000007.ARFB

BA000007.ARFB        Location/Qualifiers
FT   CDS             218178..218588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arfB"
FT                   /locus_tag="ECs_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33616"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33616"
FT                   /db_xref="GOA:Q8X8W5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8W5"
FT                   /protein_id="BAB33616.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAVIKDLTTEQKA
FT                   RRPTRPTRASKERRLASKAQKSSVKAMRSGRE"
     MIVISRHVAI PDGELEITAI RAQGAGGQHV NKTSTAIHLR FDIRASSLPE YYKERLLAAS        60
     HHLISSDGVI VIKAQEYRSQ ELNREAALAR LVAVIKDLTT EQKARRPTRP TRASKERRLA       120
     SKAQKSSVKA MRSGRE                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page