(data stored in ACNUC7421 zone)

EMBL: BA000007.AROM

BA000007.AROM        Location/Qualifiers
FT   CDS             467208..467885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="ECs_0440"
FT                   /product="AroM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33863"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33863"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEA6"
FT                   /protein_id="BAB33863.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNHLAHVSRRKVERDLQGVVEVLDNQGYDVIILMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEELLTVQAQKWQILQKPPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFNQRHRDLLQKQLDVPVLLSNVLIARLAAE
FT                   LLV"
     MSASLAILTI GIVPMQEVLP LLTEYIDEDN ISHHSLLGKL SREEVMAEYA PEAGEDTILT        60
     LLNDNHLAHV SRRKVERDLQ GVVEVLDNQG YDVIILMSTA NISSMTARNT IFLEPSRILP       120
     PLVSSIVEDH QVGVIVPVEE LLTVQAQKWQ ILQKPPVFSL GNPIHDSEQK IIDAGKELLA       180
     KGADVIMLDC LGFNQRHRDL LQKQLDVPVL LSNVLIARLA AELLV                       225
//

If you have problems or comments...

PBIL Back to PBIL home page