(data stored in ACNUC7421 zone)

EMBL: BA000007.CAIE

BA000007.CAIE        Location/Qualifiers
FT   CDS             complement(39188..39778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="ECs_0038"
FT                   /product="carnitine operon protein CaiE"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33461"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33461"
FT                   /db_xref="GOA:Q8XA36"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA36"
FT                   /protein_id="BAB33461.2"
FT                   /translation="MSYYAFEGLIPVVHPTAFVHPSAVLIGDVIVGAGVYIGPLASLRG
FT                   DYGRLIVQAGANIQDGCIMHGYTDTDTIVGENGHIGHGAILHGCVIGRDALVGMNSVIM
FT                   DGAVIGEESIVAAMSFVKAGFHGEKRQLLMGTPARAVRSVSDDELHWKRLNTKEYQDLV
FT                   GRCHASLHETQPLRQMEENRPRLQGTTDVTPKR"
     MSYYAFEGLI PVVHPTAFVH PSAVLIGDVI VGAGVYIGPL ASLRGDYGRL IVQAGANIQD        60
     GCIMHGYTDT DTIVGENGHI GHGAILHGCV IGRDALVGMN SVIMDGAVIG EESIVAAMSF       120
     VKAGFHGEKR QLLMGTPARA VRSVSDDELH WKRLNTKEYQ DLVGRCHASL HETQPLRQME       180
     ENRPRLQGTT DVTPKR                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page