(data stored in ACNUC7421 zone)

EMBL: BA000007.CITA

BA000007.CITA        Location/Qualifiers
FT   CDS             733591..735249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="ECs_0658"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CitB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34081"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34081"
FT                   /db_xref="GOA:Q8XBS0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBS0"
FT                   /protein_id="BAB34081.1"
FT                   /translation="MLQLNENKQFAFFQRLAFPLRIFLLILVFSIFVIAALAQYFTASF
FT                   EDYLTLHVRDMAMNQAKIIASNDSVISEVKTRDYKRLATIANKLQRDTDFDYVVIGDRH
FT                   SIRLYHPNPEKIGYPMQFTKQGALEKGESYFITGKGSMGMAMRAKTPIFDDDGKVIGVV
FT                   SIGYLVSKIDSWRAEFLLPMAGVFVVLLGILMLLSWFLAAHIRRQMMGMEPKQIARVVR
FT                   QQEALFSSVYEGLIAVDPHGYITAINRNARKMLGLSSPGRQWLGKPIAEVVRPADFFTE
FT                   QIDEKRQDVVANFNGLSVIANREAIRSGDDLLGAIISFRSKDEISTLNAQLTQIKQYVE
FT                   SLRTLRHEHLNWMSTLNGLLQMKEYDRVLAMVQGESQAQQQLIDSLREAFADRQVAGLL
FT                   FGKVQRARELGLKMIIVPGSQLSQLPPGLDSTEFAAIVGNLLDNAFEASLRSDEGNKIV
FT                   ELFLSDEGDDVVIEVADQGCGVPESLRDKIFEQGVSTRADEPGEHGIGLYLIASYVTRC
FT                   GGVITLEDNDPCGTLFSIYIPKVKPNDSSINPIDR"
     MLQLNENKQF AFFQRLAFPL RIFLLILVFS IFVIAALAQY FTASFEDYLT LHVRDMAMNQ        60
     AKIIASNDSV ISEVKTRDYK RLATIANKLQ RDTDFDYVVI GDRHSIRLYH PNPEKIGYPM       120
     QFTKQGALEK GESYFITGKG SMGMAMRAKT PIFDDDGKVI GVVSIGYLVS KIDSWRAEFL       180
     LPMAGVFVVL LGILMLLSWF LAAHIRRQMM GMEPKQIARV VRQQEALFSS VYEGLIAVDP       240
     HGYITAINRN ARKMLGLSSP GRQWLGKPIA EVVRPADFFT EQIDEKRQDV VANFNGLSVI       300
     ANREAIRSGD DLLGAIISFR SKDEISTLNA QLTQIKQYVE SLRTLRHEHL NWMSTLNGLL       360
     QMKEYDRVLA MVQGESQAQQ QLIDSLREAF ADRQVAGLLF GKVQRARELG LKMIIVPGSQ       420
     LSQLPPGLDS TEFAAIVGNL LDNAFEASLR SDEGNKIVEL FLSDEGDDVV IEVADQGCGV       480
     PESLRDKIFE QGVSTRADEP GEHGIGLYLI ASYVTRCGGV ITLEDNDPCG TLFSIYIPKV       540
     KPNDSSINPI DR                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page