(data stored in ACNUC7421 zone)

EMBL: BA000007.CLPP

BA000007.CLPP        Location/Qualifiers
FT   CDS             522730..523353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="ECs_0491"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33914"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33914"
FT                   /db_xref="GOA:P0A6G9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6G9"
FT                   /protein_id="BAB33914.1"
FT                   /translation="MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
     MSYSGERDNF APHMALVPMV IEQTSRGERS FDIYSRLLKE RVIFLTGQVE DHMANLIVAQ        60
     MLFLEAENPE KDIYLYINSP GGVITAGMSI YDTMQFIKPD VSTICMGQAA SMGAFLLTAG       120
     AKGKRFCLPN SRVMIHQPLG GYQGQATDIE IHAREILKVK GRMNELMALH TGQSLEQIER       180
     DTERDRFLSA PEAVEYGLVD SILTHRN                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page