(data stored in ACNUC7421 zone)

EMBL: BA000007.CSPE

BA000007.CSPE        Location/Qualifiers
FT   CDS             738648..738857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspE"
FT                   /locus_tag="ECs_0662"
FT                   /product="cold shock-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34085"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34085"
FT                   /db_xref="GOA:P0A974"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A974"
FT                   /protein_id="BAB34085.1"
FT                   /translation="MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLA
FT                   EGQRVEFEITNGAKGPSAANVIAL"
     MSKIKGNVKW FNESKGFGFI TPEDGSKDVF VHFSAIQTNG FKTLAEGQRV EFEITNGAKG        60
     PSAANVIAL                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page