(data stored in ACNUC7421 zone)

EMBL: BA000007.CUSB

BA000007.CUSB        Location/Qualifiers
FT   CDS             680015..681238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusB"
FT                   /locus_tag="ECs_0612"
FT                   /product="membrane fusion protein of copper/silver efflux
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34035"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34035"
FT                   /db_xref="GOA:Q8XEH9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XEH9"
FT                   /protein_id="BAB34035.1"
FT                   /translation="MKKIALIIGSMIAGGIISAAGFTWFAKAEPPAEKTSTAERKILFW
FT                   YDPMYPNTRFDKPGKSPFMDMDLVPKYADEESSASGVRIDPTQTQNLGVKTATVTRGPL
FT                   TFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGAPLLDLTIPDWVEAQS
FT                   EYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFD
FT                   LRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKW
FT                   TLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQR
FT                   VITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMR
FT                   SESATHAH"
     MKKIALIIGS MIAGGIISAA GFTWFAKAEP PAEKTSTAER KILFWYDPMY PNTRFDKPGK        60
     SPFMDMDLVP KYADEESSAS GVRIDPTQTQ NLGVKTATVT RGPLTFAQSF PANVSYNEYQ       120
     YAIVQARAAG FIDKVYPLTV GDKVQKGAPL LDLTIPDWVE AQSEYLLLRE TGGTATQTEG       180
     ILERLRLAGM PEADIRRLIA TQKIQTRFTL KAPIDGVITA FDLRAGMNIA KDNVVAKIQG       240
     MDPVWVTAAI PESIAWLVKD ASQFTLTVPA RPDKTLTIRK WTLLPGVDAA TRTLQLRLEV       300
     DNADEALKPG MNAWLQLNTA SEPMLLIPSQ ALIDTGSEQR VITVDADGRF VPKRVAVFQA       360
     SQGVTALRSG LAEGEKVVSS GLFLIDSEAN ISGALERMRS ESATHAH                     407
//

If you have problems or comments...

PBIL Back to PBIL home page