(data stored in ACNUC7421 zone)

EMBL: BA000007.CUSF

BA000007.CUSF        Location/Qualifiers
FT   CDS             679667..679999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="ECs_0611"
FT                   /product="Cu(I)/Ag(I) efflux system periplasmic protein
FT                   CusF"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34034"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34034"
FT                   /db_xref="GOA:Q8XBY2"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBY2"
FT                   /protein_id="BAB34034.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVK
FT                   GFDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSGIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
     MKKALQVAMF SLFTVIGFNA QANEHHHETM SEAQPQVISA TGVVKGFDLE SKKITIHHDP        60
     IAAVNWPEMT MRFTITPQTK MSGIKTGDKV AFNFVQQGNL SLLQDIKVSQ                  110
//

If you have problems or comments...

PBIL Back to PBIL home page