(data stored in ACNUC7421 zone)

EMBL: BA000007.CUSS

BA000007.CUSS        Location/Qualifiers
FT   CDS             complement(675983..677431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="ECs_0608"
FT                   /product="copper-sensing histidine kinase in two-component
FT                   regulatory system with CusR"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34031"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34031"
FT                   /db_xref="GOA:Q8XBY4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBY4"
FT                   /protein_id="BAB34031.1"
FT                   /translation="MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAE
FT                   QDINDLKEISATLERVLNHPDETQARRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGA
FT                   PDIREFARDAIPDKDARGGEVFLLSGPTMMMPGHGHGHMEHSNWRMISLPVGPLVDGKP
FT                   IYTLYIALSIDFHLHYINDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQN
FT                   ITSKDLDVRLDPQTVPIELEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLI
FT                   TQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLAD
FT                   EVGKVFDFFEALAEDRGVELQFVGDECQVAGDPLMLRRALSNLLSNALRYTPPGEAIVV
FT                   RCQTVDHLVQVIVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVA
FT                   HKGTVAVTSNARGTRFVIVLPERG"
     MVSKPFQRPF SLATRLTFFI SLATIAAFFA FAWIMIHSVK VHFAEQDIND LKEISATLER        60
     VLNHPDETQA RRLMTLEDIV SGYSNVLISL ADSHGKTVYH SPGAPDIREF ARDAIPDKDA       120
     RGGEVFLLSG PTMMMPGHGH GHMEHSNWRM ISLPVGPLVD GKPIYTLYIA LSIDFHLHYI       180
     NDLMNKLIMT ASVISILIVF IVLLAVHKGH APIRSVSRQI QNITSKDLDV RLDPQTVPIE       240
     LEQLVLSFNH MIERIEDVFT RQSNFSADIA HEIRTPITNL ITQTEIALSQ SRSQKELEDV       300
     LYSNLEELTR MAKMVSDMLF LAQADNNQLI PEKKMLNLAD EVGKVFDFFE ALAEDRGVEL       360
     QFVGDECQVA GDPLMLRRAL SNLLSNALRY TPPGEAIVVR CQTVDHLVQV IVENPGTPIA       420
     PEHLPRLFDR FYRVDPSRQR KGEGSGIGLA IVKSIVVAHK GTVAVTSNAR GTRFVIVLPE       480
     RG                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page