(data stored in ACNUC7421 zone)

EMBL: BA000007.DNAQ

BA000007.DNAQ        Location/Qualifiers
FT   CDS             239609..240349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ECs_0211"
FT                   /product="DNA polymerase III epsilon subunit DnaQ"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33634"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33634"
FT                   /db_xref="GOA:Q8X7Y5"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Y5"
FT                   /protein_id="BAB33634.2"
FT                   /translation="MTAMSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRR
FT                   LTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAA
FT                   FDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRT
FT                   LHGALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRLVRQASKLRVVFATD
FT                   EELAAHEARLDLVQKKGGSCLWRA"
     MTAMSTAITR QIVLDTETTG MNQIGAHYEG HKIIEIGAVE VVNRRLTGNN FHVYLKPDRL        60
     VDPEAFGVHG IADEFLLDKP TFAEVADEFM DYIRGAELVI HNAAFDIGFM DYEFSLLKRD       120
     IPKTNTFCKV TDSLAVARKM FPGKRNSLDA LCARYEIDNS KRTLHGALLD AQILAEVYLA       180
     MTGGQTSMAF AMEGETQQQQ GEATIQRLVR QASKLRVVFA TDEELAAHEA RLDLVQKKGG       240
     SCLWRA                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page