(data stored in ACNUC7421 zone)

EMBL: BA000007.ERPA

BA000007.ERPA        Location/Qualifiers
FT   CDS             180810..181154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="erpA"
FT                   /locus_tag="ECs_0160"
FT                   /product="iron-sulfur cluster insertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33583"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33583"
FT                   /db_xref="GOA:P0ACC5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACC5"
FT                   /protein_id="BAB33583.1"
FT                   /translation="MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
     MSDDVALPLE FTDAAANKVK SLIADEDNPN LKLRVYITGG GCSGFQYGFT FDDQVNEGDM        60
     TIEKQGVGLV VDPMSLQYLV GGSVDYTEGL EGSRFIVTNP NAKSTCGCGS SFSI             114
//

If you have problems or comments...

PBIL Back to PBIL home page