(data stored in ACNUC7421 zone)

EMBL: BA000007.ESPX1

BA000007.ESPX1       Location/Qualifiers
FT   CDS             complement(23330..24751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espX1"
FT                   /locus_tag="ECs_0025"
FT                   /product="T3SS effector-like protein EspX"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33448"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33448"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA51"
FT                   /protein_id="BAB33448.1"
FT                   /translation="MTDGISTSPHCLYKSNIVDDVIINKTRQNELVKVFCEYKTEFLIL
FT                   FDDFFRSQDLPKPSPVLHHFFQYTHLRDAHFYRCKLIEHTVQFSFFKHKGITLLRLDVF
FT                   DDRTSECLSEEIKIYQECHEKFIKFLKANFNQEIYPELYTPEIFYEACRNLQSFYDHQE
FT                   TSQNAKYSAIVKKKSYFNKEIRNLIKKNIYPELYNEQCNKIPASSTDDNQKITWQNFKT
FT                   SNAAYSQLCEKLSLLKSSPSRLIEKSAYCSNENMITDKFDVVFSYCGDNVKEFILLLPY
FT                   NKSLEMHELNEQNIQYLTALNINIHKLLLSNITIEKSNLSYGYYFGCVLSNISCFESDL
FT                   SNTIFSNGEINNLFIKKSNIFGTSFTNTMIKNLRCEDIMPGRWTTQLVNKHLGYRYTGV
FT                   FKTLASIDDKPSRFEILIPLVQTLVRDNVKLNNDVYKELKKFMHDYDKTSPEMRKYLQS
FT                   INESMFLMKKISHQD"
     MTDGISTSPH CLYKSNIVDD VIINKTRQNE LVKVFCEYKT EFLILFDDFF RSQDLPKPSP        60
     VLHHFFQYTH LRDAHFYRCK LIEHTVQFSF FKHKGITLLR LDVFDDRTSE CLSEEIKIYQ       120
     ECHEKFIKFL KANFNQEIYP ELYTPEIFYE ACRNLQSFYD HQETSQNAKY SAIVKKKSYF       180
     NKEIRNLIKK NIYPELYNEQ CNKIPASSTD DNQKITWQNF KTSNAAYSQL CEKLSLLKSS       240
     PSRLIEKSAY CSNENMITDK FDVVFSYCGD NVKEFILLLP YNKSLEMHEL NEQNIQYLTA       300
     LNINIHKLLL SNITIEKSNL SYGYYFGCVL SNISCFESDL SNTIFSNGEI NNLFIKKSNI       360
     FGTSFTNTMI KNLRCEDIMP GRWTTQLVNK HLGYRYTGVF KTLASIDDKP SRFEILIPLV       420
     QTLVRDNVKL NNDVYKELKK FMHDYDKTSP EMRKYLQSIN ESMFLMKKIS HQD              473
//

If you have problems or comments...

PBIL Back to PBIL home page