(data stored in ACNUC7421 zone)

EMBL: BA000007.ESPY1

BA000007.ESPY1       Location/Qualifiers
FT   CDS             63450..64202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espY1"
FT                   /locus_tag="ECs_0061"
FT                   /product="T3SS effector-like protein EspY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33484"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33484"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA11"
FT                   /protein_id="BAB33484.1"
FT                   /translation="MKVSVPGMPATLLNMSNNDIYKMVSGDKMDMKMNIFQRLWETLRH
FT                   LFWSDKQTEAYKLLFNFVNKKAGNINASKYFTGAVNENEKEKFIHSLELFNELKTCAKN
FT                   PDEMVAKGNMSWVAQTFGDIELSVTFFIENKEICTQTLQLHKGPGNLGVDLREAYLPGV
FT                   DMRDCYLGLKTMKGHNKVLYLEPGWNANLDGATLDGATLDGATVDGATHLYDEVIIINK
FT                   ITPKKIDTEEVATKQSTAEQITDNAIIE"
     MKVSVPGMPA TLLNMSNNDI YKMVSGDKMD MKMNIFQRLW ETLRHLFWSD KQTEAYKLLF        60
     NFVNKKAGNI NASKYFTGAV NENEKEKFIH SLELFNELKT CAKNPDEMVA KGNMSWVAQT       120
     FGDIELSVTF FIENKEICTQ TLQLHKGPGN LGVDLREAYL PGVDMRDCYL GLKTMKGHNK       180
     VLYLEPGWNA NLDGATLDGA TLDGATVDGA THLYDEVIII NKITPKKIDT EEVATKQSTA       240
     EQITDNAIIE                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page