(data stored in ACNUC7421 zone)

EMBL: BA000007.ESPY2

BA000007.ESPY2       Location/Qualifiers
FT   CDS             80672..81241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espY2"
FT                   /locus_tag="ECs_0073"
FT                   /product="T3SS effector-like protein EspY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33496"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33496"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA03"
FT                   /protein_id="BAB33496.1"
FT                   /translation="MKVRNPEQISIPASNTTKDPGLTNSQIIRMANLVKKTENMNIFEE
FT                   LWETLRNLFQSDKHSQTAARQILKDAFYFQNSDDYSKYFTGAVDGKARDKLTHWLIKFN
FT                   ELKEYAKDPENMAAKASLSPEGTLCVSFFIGDEAIFTLELQLKKSTRTGGIDLSNAYFN
FT                   GVVICGIDCLEVDLSNAETNNSRWYD"
     MKVRNPEQIS IPASNTTKDP GLTNSQIIRM ANLVKKTENM NIFEELWETL RNLFQSDKHS        60
     QTAARQILKD AFYFQNSDDY SKYFTGAVDG KARDKLTHWL IKFNELKEYA KDPENMAAKA       120
     SLSPEGTLCV SFFIGDEAIF TLELQLKKST RTGGIDLSNA YFNGVVICGI DCLEVDLSNA       180
     ETNNSRWYD                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page