(data stored in ACNUC7421 zone)

EMBL: BA000007.ESPY3

BA000007.ESPY3       Location/Qualifiers
FT   CDS             complement(501538..503109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espY3"
FT                   /locus_tag="ECs_0472"
FT                   /product="T3SS effector-like protein EspY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33895"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33895"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE85"
FT                   /protein_id="BAB33895.1"
FT                   /translation="MMKTITKQPILFTDVPVADLRNSMKQDLNQNLIERLWNKIRDFFL
FT                   DSDKQKAFKSIHKYINTLSVLNYNSALTPDPNFNIDATSDLDSYLKLDFDRLSPKQKQT
FT                   TLCCFWNKIASSLPEPYNSTIKHNIIFYKDGENLMIRGTISIVNEVVKTYSLPIEKDDN
FT                   GYYDFSGLYLAHSNISGKDPNKDPDIDFGIDMGNCNCSNVNFEHTYFYGVKFTNANCTN
FT                   ANFNNCRFKKCDLTNMNCTGAILDNAMIYGKEKEPEMQYPEADQIIQRITYQKSDGNET
FT                   KGMILTNCSCVKTTFNWADLSESDCQNVDFSEANLSNTILPDIVRMKGTKLYRTDLFNP
FT                   ILKTEAESTEEKDISPLAKIILDYIESDKNPESLNFEEKSTVIKIKQDIDNFIFYNQHL
FT                   KKIFNRAMNLQEKISRKKYNEFFKYIQAEAKQYFKDQYKLTKNDYLKKVPLTAQLIAKY
FT                   KMDDQLDQLLVTREIQDEIKSKIQDKIDELSKNLFNTMTETIENNFDDIFRQQSENMSN
FT                   YYEFVD"
     MMKTITKQPI LFTDVPVADL RNSMKQDLNQ NLIERLWNKI RDFFLDSDKQ KAFKSIHKYI        60
     NTLSVLNYNS ALTPDPNFNI DATSDLDSYL KLDFDRLSPK QKQTTLCCFW NKIASSLPEP       120
     YNSTIKHNII FYKDGENLMI RGTISIVNEV VKTYSLPIEK DDNGYYDFSG LYLAHSNISG       180
     KDPNKDPDID FGIDMGNCNC SNVNFEHTYF YGVKFTNANC TNANFNNCRF KKCDLTNMNC       240
     TGAILDNAMI YGKEKEPEMQ YPEADQIIQR ITYQKSDGNE TKGMILTNCS CVKTTFNWAD       300
     LSESDCQNVD FSEANLSNTI LPDIVRMKGT KLYRTDLFNP ILKTEAESTE EKDISPLAKI       360
     ILDYIESDKN PESLNFEEKS TVIKIKQDID NFIFYNQHLK KIFNRAMNLQ EKISRKKYNE       420
     FFKYIQAEAK QYFKDQYKLT KNDYLKKVPL TAQLIAKYKM DDQLDQLLVT REIQDEIKSK       480
     IQDKIDELSK NLFNTMTETI ENNFDDIFRQ QSENMSNYYE FVD                         523
//

If you have problems or comments...

PBIL Back to PBIL home page