(data stored in ACNUC7421 zone)

EMBL: BA000007.FABZ

BA000007.FABZ        Location/Qualifiers
FT   CDS             205445..205900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="ECs_0182"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33605"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33605"
FT                   /db_xref="GOA:P0A6Q8"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6Q8"
FT                   /protein_id="BAB33605.2"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
     MTTNTHTLQI EEILELLPHR FPFLLVDRVL DFEEGRFLRA VKNVSVNEPF FQGHFPGKPI        60
     FPGVLILEAM AQATGILAFK SVGKLEPGEL YYFAGIDEAR FKRPVVPGDQ MIMEVTFEKT       120
     RRGLTRFKGV ALVDGKVVCE ATMMCARSRE A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page