(data stored in ACNUC7421 zone)

EMBL: BA000007.FEPE

BA000007.FEPE        Location/Qualifiers
FT   CDS             699911..701044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepE"
FT                   /locus_tag="ECs_0626"
FT                   /product="regulator of length of O-antigen component of
FT                   lipopolysaccharide chains"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34049"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34049"
FT                   /db_xref="GOA:Q8XBV8"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="PDB:3B8M"
FT                   /db_xref="PDB:3B8N"
FT                   /db_xref="PDB:4E2L"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBV8"
FT                   /protein_id="BAB34049.1"
FT                   /translation="MSSLNIKQGSDAHFPDYPLASPSNNEIDLLNLISVLWRAKKTVMA
FT                   VVFAFACAGLLISFILPQKWTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAF
FT                   NLFIKKFQSVSLLEEYLRSSPYVMDQLKEAKIDELDLHRAIVALSEKMKAVDDNASKKK
FT                   DEPSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESIENVRNKLEIKTQFEKEKL
FT                   AQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVYSNGQAVKDDPDFSISLGADGIERK
FT                   LEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLPVKKDGPGKAI
FT                   IVILSALIGGMVACGSVLLRYAMASRKQDAMMADHLV"
     MSSLNIKQGS DAHFPDYPLA SPSNNEIDLL NLISVLWRAK KTVMAVVFAF ACAGLLISFI        60
     LPQKWTSAAV VTPPEPVQWQ ELEKTFTKLR VLDLDIKIDR TEAFNLFIKK FQSVSLLEEY       120
     LRSSPYVMDQ LKEAKIDELD LHRAIVALSE KMKAVDDNAS KKKDEPSLYT SWTLSFTAPT       180
     SEEAQTVLSG YIDYISALVV KESIENVRNK LEIKTQFEKE KLAQDRIKMK NQLDANIQRL       240
     NYSLDIANAA GIKKPVYSNG QAVKDDPDFS ISLGADGIER KLEIEKAVTD VAELNGELRN       300
     RQYLVEQLTK ANINDVNFTP FKYQLSPSLP VKKDGPGKAI IVILSALIGG MVACGSVLLR       360
     YAMASRKQDA MMADHLV                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page