(data stored in ACNUC7421 zone)

EMBL: BA000007.FHUD

BA000007.FHUD        Location/Qualifiers
FT   CDS             174898..175788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="ECs_0156"
FT                   /product="iron(3+)-hydroxamate import ABC transporter
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33579"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33579"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8Z7"
FT                   /protein_id="BAB33579.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPESVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIR
FT                   SMNPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
     MSGLPLISRR RLLTAMALSP LLWQMNTAHA AAIDPNRIVA LEWLPVELLL ALGIVPYGVA        60
     DTINYRLWVS EPPLPESVID VGLRTEPNLE LLTEMKPSFM VWSAGYGPSP EMLARIAPGR       120
     GFNFSDGKQP LAMARKSLTE MADLLNLQSA AETHLAQYED FIRSMNPRFV KRGARPLLLT       180
     TLIDPRHMLV FGPNSLFQEI LDEYGIPNAW QGETNFWGST AVSIDRLAAY KDVDVLCFDH       240
     DNSKDMDALM ATPLWQAMPF VRAGRFQRVP AVWFYGATLS AMHFVRVLDN AIGGKA           296
//

If you have problems or comments...

PBIL Back to PBIL home page