(data stored in ACNUC7421 zone)

EMBL: BA000007.FIXA

BA000007.FIXA        Location/Qualifiers
FT   CDS             46817..47587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="ECs_0044"
FT                   /product="anaerobic carnitine reduction electron transfer
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33467"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33467"
FT                   /db_xref="GOA:P60567"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60567"
FT                   /protein_id="BAB33467.2"
FT                   /translation="MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAA
FT                   CQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASAL
FT                   AAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVEREL
FT                   EDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAEAAWSEQ
FT                   QVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
     MKIITCYKCV PDEQDIAVNN ADGSLDFSKA DAKISQYDLN AIEAACQLKQ QAAEAQVTAL        60
     SVGGKALTNA KGRKDVLSRG PDELIVVIDD QFEQALPQQT ASALAAAAQK AGFDLILCGD       120
     GSSDLYAQQV GLLVGEILNI PAVNGVSKII SLTADTLTVE RELEDETETL SIPLPAVVAV       180
     STDINSPQIP SMKAILGAAK KPVQVWSAAD IGFNAEAAWS EQQVAAPKQR ERQRIVIEGD       240
     GEEQIAAFAE NLRKVI                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page